NSJ Bioreagents

RRM2 Antibody

Product Code:
 
NSJ-R32063
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
 
After reconstitution, the RRM2 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 2
Western blot testing of 1) rat heart, 2) mouse heart, 3) human A431 and 4) human HeLa lysate with RRM2 antibody. Expected/observed molecular weight: 45~50 kDa.~
2 / 2
IHC testing of FFPE human breast cancer tissue with RRM2 antibody. HIER: Boil the para
❮❯

Western blot testing of 1) rat heart, 2) mouse heart, 3) human A431 and 4) human HeLa lysate with RRM2 antibody. Expected/observed molecular weight: 45~50 kDa.~
IHC testing of FFPE human breast cancer tissue with RRM2 antibody. HIER: Boil the para

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R32063-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
How to order with us   Contact us
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml
Application Note:
Optimal dilution of the RRM2 antibody should be determined by the researcher.
Description:
Ribonucleoside-diphosphate reductase subunit M2, also known as ribonucleotide reductase small subunit, is an enzyme that in humans is encoded by the RRM2 gene. It is mapped to 2p25-p24. This gene encodes one of two non-identical subunits for ribonucleotide reductase. This reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. Synthesis of the encoded protein (M2) is regulated in a cell-cycle dependent fashion. Transcription from this gene can initiate from alternative promoters, which results in two isoforms which differ in the lengths of their N-termini. Related pseudogenes have been identified on chromosomes 1 and X.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENT of human RRM2 were used as the immunogen for the RRM2 antibody.
Limitation:
This RRM2 antibody is available for research use only.
Localization:
Cytoplasmic, membrane
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P31350